PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g13360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 352aa    MW: 39239.8 Da    PI: 4.9606
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g13360.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.43.3e-0955100342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      ++C+ +e+ ++ + C+ +   lC +C   +H+       H +vp+
  Vang02g13360.1  55 VWVCEACERAPAAFLCKADAASLCTSCDADIHSAnplasrHHRVPI 100
                     689*****************************66899999877775 PP

2CCT70.35e-24282325144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eK+ktRkFeKkirY+sRKa+Ae+RpR+KGrF+k++
  Vang02g13360.1 282 REARVLRYREKKKTRKFEKKIRYASRKAYAETRPRIKGRFAKRT 325
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0141257IPR000315B-box-type zinc finger
CDDcd000210.002892057No hitNo description
PROSITE profilePS5011910.99353100IPR000315B-box-type zinc finger
PfamPF006433.4E-754100IPR000315B-box-type zinc finger
CDDcd000219.11E-856100No hitNo description
SMARTSM003361.7E-858100IPR000315B-box-type zinc finger
PROSITE profilePS5101716.827282324IPR010402CCT domain
PfamPF062037.7E-18282324IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MPRESTLDPN VHVSPSCATN TPCIVYCHAD SAYLCSSCDA RVHAANRVAS RHERVWVCEA  60
CERAPAAFLC KADAASLCTS CDADIHSANP LASRHHRVPI LPILGPLLVE PDHEPEHGFV  120
NEVEEEEEEV FDEYDDEIEA ASWLLPHPVK GNQEEENGFL YGDEYLDNLV DCNSCGHHNQ  180
FSNVFQQQQN YNTVPQNYAV VPVQVLQQLQ HFQPGLEFDS SKAGFSYDGS ISQSVSVSSM  240
EVGVVPESTI SDISVSYSKS PIGTSDLFPP LPMPSHLTPM DREARVLRYR EKKKTRKFEK  300
KIRYASRKAY AETRPRIKGR FAKRTDVEAE VDQMLSTALF NEVGGTIFPS F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509740.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-109COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A0L9VN160.0A0A0L9VN16_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T8P40.0A0A0S3T8P4_PHAAN; Uncharacterized protein
STRINGGLYMA13G07030.11e-174(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.15e-69CONSTANS-like 2